PANK2 (NM_153638) Human Recombinant Protein

SKU
TP315676
Recombinant protein of human pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215676 representing NM_153638
Red=Cloning site Green=Tags(s)

MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG
PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS
ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL
FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG
NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID
SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA
RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV
GALLELLKIP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 59.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_705902
Locus ID 80025
UniProt ID Q9BZ23
Cytogenetics 20p13
RefSeq Size 2280
RefSeq ORF 1710
Synonyms C20orf48; HARP; HSS; NBIA1; PKAN
Summary This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis
Write Your Own Review
You're reviewing:PANK2 (NM_153638) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315676 PANK2 MS Standard C13 and N15-labeled recombinant protein (NP_705902) 10 ug
$3,255.00
LC406998 PANK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406999 PANK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410958 PANK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406998 Transient overexpression lysate of pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$665.00
LY406999 Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 2 100 ug
$436.00
LY410958 Transient overexpression lysate of pantothenate kinase 2 (PANK2), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.