Growth Hormone (GH1) (NM_000515) Human Recombinant Protein

SKU
TP315644
Recombinant protein of human growth hormone 1 (GH1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215644 protein sequence
Red=Cloning site Green=Tags(s)

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSF
LQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL
KDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS
VEGSCGF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000506
Locus ID 2688
UniProt ID P01241
Cytogenetics 17q23.3
RefSeq Size 860
RefSeq ORF 651
Synonyms GH; GH-N; GHB5; GHN; hGH-N; IGHD1A; IGHD1B; IGHD2
Summary The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:Growth Hormone (GH1) (NM_000515) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309608 GH1 MS Standard C13 and N15-labeled recombinant protein (NP_072053) 10 ug
$3,255.00
PH315644 GH1 MS Standard C13 and N15-labeled recombinant protein (NP_000506) 10 ug
$3,255.00
LC411627 GH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424673 GH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411627 Transient overexpression lysate of growth hormone 1 (GH1), transcript variant 2 100 ug
$436.00
LY424673 Transient overexpression lysate of growth hormone 1 (GH1), transcript variant 1 100 ug
$436.00
TP309608 Recombinant protein of human growth hormone 1 (GH1), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.