GCET2 (GCSAM) (NM_001008756) Human Recombinant Protein

SKU TP315443L

Recombinant protein of human germinal center expressed transcript 2 (GCET2), transcript variant 2, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215443 representing NM_001008756; Red=Cloning site Green=Tags(s); ; MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSST; PIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRH; ARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001008756
• Locus ID: 257144
• UniProt ID: Q8N6F7
• Cytogenetics: 3q13.2
• RefSeq Size: 3481
• RefSeq ORF: 339
• Synonyms: GCAT2; germinal center-associated lymphoma; germinal center B cell associated-protein 2; germinal center expressed transcript 2; HGAL; MGC40441
• Summary: This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]