FUBP3 (NM_003934) Human Recombinant Protein

SKU
TP315402
Purified recombinant protein of Homo sapiens far upstream element (FUSE) binding protein 3 (FUBP3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215402 representing NM_003934
Red=Cloning site Green=Tags(s)

MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPLDDGVGNQLGA
LVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPESIEQAKRL
LGQIVDRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADK
PLRITGDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQ
NDAGVRIQFKPDDGISPERAAQVMGPPDRCQHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGA
PGGVQEITYTVPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNSDPNLRRFTIRGVPQQIEVARQL
IDEKVGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPRSSGCFPNMAAKVNGNPHSTPVSGPPAFLTQGWGS
TYQAWQQPTQQVPSQQSQPQSSQPNYSKAWEDYYKKQSHAASAAPQASSPPDYTMAWAEYYRQQVAFYGQ
TLGQAQAHSQEQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003925
Locus ID 8939
UniProt ID Q96I24
Cytogenetics 9q34.11-q34.12
RefSeq Size 3175
RefSeq ORF 1716
Synonyms FBP3
Summary May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FUBP3 (NM_003934) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315402 FUBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003925) 10 ug
$3,255.00
LC418344 FUBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418344 Transient overexpression lysate of far upstream element (FUSE) binding protein 3 (FUBP3) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.