PHACTR2 (NM_001100164) Human Recombinant Protein

SKU
TP315312
Recombinant protein of human phosphatase and actin regulator 2 (PHACTR2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215312 representing NM_001100164
Red=Cloning site Green=Tags(s)

MGQTSVSTLSPQPGSVDGLDKASIANSDGPTAGSQTPPFKRKGKLSTIGKIFKPWKWRKKKTSDKFRETS
AVLERKISTRQSREELIRRGVLKELPDQDGDVTVNFENSNGHMIPIGEESTREENVVKSEEGNGSVSEKT
PPLEEQAEDKKENTENHSETPAAPALPPSAPPKPRPKPKPKKSPVPPKGATAGASHKGDEVPPIKKNTKA
PGKQAPVPPPKPASRNTTREAAGSSHSKKTTGSKASASPSTSSTSSRPKASKETVSSKAGTVGTTKGKRK
TDKQPITSHLSSDTTTSGTSDLKGEPAETRVESFKLEQTVPGAEEQNTGKFKSMVPPPPVAPAPSPLAPP
LPLEDQCITASDTPVVLVSVGADLPVSALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGK
TVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDGPILYTDDEDEDEDEDGSGESALASKIRRRDTL
AIKLGNRPSKKELEDKNILQRTSEEERQEIRQQIGTKLVRRLSQRPTTEELEQRNILKQKNEEEEQEAKM
ELKRRLSRKLSLRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEM
EVHEESRQFTRFHRP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 70.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001093634
Locus ID 9749
UniProt ID O75167
Cytogenetics 6q24.2
RefSeq Size 9642
RefSeq ORF 1935
Synonyms C6orf56
Write Your Own Review
You're reviewing:PHACTR2 (NM_001100164) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315312 PHACTR2 MS Standard C13 and N15-labeled recombinant protein (NP_001093634) 10 ug
$3,255.00
LC415095 PHACTR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420232 PHACTR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415095 Transient overexpression lysate of phosphatase and actin regulator 2 (PHACTR2), transcript variant 3 100 ug
$665.00
LY420232 Transient overexpression lysate of phosphatase and actin regulator 2 (PHACTR2), transcript variant 1 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.