Amylin (IAPP) (NM_000415) Human Recombinant Protein

SKU TP315074L

Recombinant protein of human islet amyloid polypeptide precursor (IAPP), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215074 representing NM_000415; Red=Cloning site Green=Tags(s); ; MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY; GKRNAVEVLKREPLNYLPL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 3.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000406
• Locus ID: 3375
• UniProt ID: P10997
• Cytogenetics: 12p12.1
• RefSeq Size: 1462
• RefSeq ORF: 267
• Synonyms: DAP; IAP
• Summary: This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Maturity onset diabetes of the young