EGFR (NM_201283) Human Recombinant Protein
SKU
TP314877
Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC214877 representing NM_201283
Red=Cloning site Green=Tags(s) MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNL QEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKL TKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVN PEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGLS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_958440 |
Locus ID | 1956 |
UniProt ID | P00533 |
Cytogenetics | 7p11.2 |
RefSeq Size | 1595 |
RefSeq ORF | 1215 |
Synonyms | ERBB; ERBB1; ERRP; HER1; mENA; NISBD2; PIG61 |
Summary | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2). [provided by RefSeq, Jul 2020] |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Secreted Protein, Stem cell relevant signaling - JAK/STAT signaling pathway, Transmembrane |
Protein Pathways | Adherens junction, Bladder cancer, Calcium signaling pathway, Colorectal cancer, Cytokine-cytokine receptor interaction, Dorso-ventral axis formation, Endocytosis, Endometrial cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, MAPK signaling pathway, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH314877 | EGFR MS Standard C13 and N15-labeled recombinant protein (NP_958440) | 10 ug |
$3,255.00
|
|
LC404514 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC404515 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417434 | EGFR HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY404514 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 2 | 100 ug |
$665.00
|
|
LY404515 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 3 | 100 ug |
$436.00
|
|
LY417434 | Transient overexpression lysate of epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), transcript variant 1 | 100 ug |
$665.00
|
|
TP700043 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 25-645 aa, expressed in human cells | 20 ug |
$867.00
|
|
TP700065 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant L858R, with C-terminal MYC/DDK tag, expressed in human cells, 20ug | 20 ug |
$867.00
|
|
TP700080 | Purified protein of Homo sapiens epidermal growth factor receptor (EGFR), transcript variant 1, mutant K745_K750del, with C-terminal MYC/DDK tag, expressed in human cells, 20ug | 20 ug |
$867.00
|
|
TP700103 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells | 20 ug |
$867.00
|
|
TP700204 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR) extracellular domain, residues Leu25-Gly378, transcript variant 3 | 20 ug |
$867.00
|
|
TP710003 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR),residues 1-645aa,expressed in sf9 cells | 20 ug |
$515.00
|
|
TP710011 | Recombinant protein of human epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) (EGFR), full length, with C-terminal DDK tag, expressed in sf9 cells | 20 ug |
$515.00
|
|
TP710358 | Purified recombinant protein of Human epidermal growth factor receptor (EGFR), transcript variant 1, esidues 669-1210aa, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.