PPAR delta (PPARD) (NM_006238) Human Recombinant Protein

SKU
TP314735
Recombinant protein of human peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214735 representing NM_006238
Red=Cloning site Green=Tags(s)

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL
NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP
FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT
LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL
FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006229
Locus ID 5467
UniProt ID Q03181
Cytogenetics 6p21.31
RefSeq Size 3328
RefSeq ORF 1323
Synonyms FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB
Summary This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcriptional activity of peroxisome proliferator activated receptors alpha and gamma, though evidence for this effect is inconsistent. Expression of this gene in colorectal cancer cells may be variable but is typically relatively low. Knockout studies in mice suggested a role for this protein in myelination of the corpus callosum, lipid metabolism, differentiation, and epidermal cell proliferation. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer, PPAR signaling pathway, Wnt signaling pathway
Write Your Own Review
You're reviewing:PPAR delta (PPARD) (NM_006238) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314735 PPARD MS Standard C13 and N15-labeled recombinant protein (NP_006229) 10 ug
$3,255.00
LC416782 PPARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432912 PPARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433008 PPARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433089 PPARD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416782 Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1 100 ug
$665.00
LY432912 Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 5 100 ug
$436.00
LY433008 Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 4 100 ug
$436.00
LY433089 Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.