GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein

SKU
TP314619
Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC214619
Blue=ORF Red=Cloning site Green=Tag(s)

MVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSI
FAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIG
LDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETR
NDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYAD
EMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHI
RDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYENVSKS

myc-FLAG tag

Recombinant protein using RC214619 also available, TP314619
Tag C-Myc/DDK
Predicted MW 47 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_109594
Locus ID 5800
UniProt ID Q16827
Cytogenetics 12p13-p12
RefSeq Size 3970
RefSeq ORF 1215
Synonyms GLEPP1; NPHS6; PTP-OC; PTP-U2; PTPROT; PTPU2; R-PTP-O
Summary This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer. [provided by RefSeq, May 2011]
Protein Families Phosphatase, Transmembrane
Write Your Own Review
You're reviewing:GLEPP1 (PTPRO) (NM_030669) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314619 PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109594) 10 ug
$3,255.00
PH320785 PTPRO MS Standard C13 and N15-labeled recombinant protein (NP_109596) 10 ug
$3,255.00
LC403070 PTPRO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410736 PTPRO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410737 PTPRO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410739 PTPRO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403070 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 1 100 ug
$665.00
LY410736 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 4 100 ug
$436.00
LY410737 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 3 100 ug
$436.00
LY410739 Transient overexpression lysate of protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5 100 ug
$436.00
TP320785 Recombinant protein of human protein tyrosine phosphatase, receptor type, O (PTPRO), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.