Epigen (EPGN) (NM_001013442) Human Recombinant Protein

SKU
TP314501
Recombinant protein of human epithelial mitogen homolog (mouse) (EPGN), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214501 representing NM_001013442
Red=Cloning site Green=Tags(s)

MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHEL
EKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001013460
Locus ID 255324
UniProt ID Q6UW88
Cytogenetics 4q13.3
RefSeq Size 847
RefSeq ORF 399
Synonyms ALGV3072; EPG; epigen; PRO9904
Summary The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Epigen (EPGN) (NM_001013442) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314501 EPGN MS Standard C13 and N15-labeled recombinant protein (NP_001013460) 10 ug
$3,255.00
LC422978 EPGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422978 Transient overexpression lysate of epithelial mitogen homolog (mouse) (EPGN) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.