CYP2A7 (NM_030589) Human Recombinant Protein

SKU
TP314234
Recombinant protein of human cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214234 representing NM_030589
Red=Cloning site Green=Tags(s)

MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKVSQGVAFSNG
ERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRF
DYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDP
NSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEI
DRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRD
PSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDI
DVSPKHVVFATIPRNYTMSFLPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_085079
Locus ID 1549
UniProt ID P20853
Cytogenetics 19q13.2
RefSeq Size 2128
RefSeq ORF 1329
Synonyms CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum; its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism
Write Your Own Review
You're reviewing:CYP2A7 (NM_030589) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313527 CYP2A7 MS Standard C13 and N15-labeled recombinant protein (NP_000755) 10 ug
$3,255.00
PH314234 CYP2A7 MS Standard C13 and N15-labeled recombinant protein (NP_085079) 10 ug
$3,255.00
LC410788 CYP2A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424531 CYP2A7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410788 Transient overexpression lysate of cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 2 100 ug
$665.00
LY424531 Transient overexpression lysate of cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 1 100 ug
$665.00
TP313527 Recombinant protein of human cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.