FOXP1 (NM_032682) Human Recombinant Protein
CAT#: TP313862
Recombinant protein of human forkhead box P1 (FOXP1), transcript variant 1, 20 µg
View other "FOXP1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213862 representing NM_032682
Red=Cloning site Green=Tags(s) MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLL QQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQ QQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPG QPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQ LELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNE IYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQ SSHAYCTPLSAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAV HPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 75.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116071 |
Locus ID | 27086 |
UniProt ID | Q9H334, Q548T7 |
Cytogenetics | 3p13 |
Refseq Size | 6222 |
Refseq ORF | 2031 |
Synonyms | 12CC4; hFKH1B; HSPC215; MFH; QRF1 |
Summary | This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403191 | FOXP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY403191 | Transient overexpression lysate of forkhead box P1 (FOXP1), transcript variant 1 |
USD 665.00 |
|
PH313862 | FOXP1 MS Standard C13 and N15-labeled recombinant protein (NP_116071) |
USD 3,255.00 |
|
TP710030 | Recombinant protein of human forkhead box P1 (FOXP1), transcript variant 1,full length, with C-terminal DDK tag, expressed in sf9 cells |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review