OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXP1 (NM_032682) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313862
Recombinant protein of human forkhead box P1 (FOXP1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA506702 FOXP1 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FOXP1 or NM_032682"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213862 representing NM_032682
Red=Cloning site Green=Tags(s)

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLL
QQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQ
QQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPG
QPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ
LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQ
LELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNE
IYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQ
SSHAYCTPLSAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAV
HPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 75.1 kDa
Concentration >0.2 mg/mL as determined by microplate BCA method
Purity >90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 50 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116071
Locus ID 27086
UniProt ID Q9H334
Cytogenetics 3p13
RefSeq Size 6222
RefSeq ORF 2031
Synonyms 12CC4; hFKH1B; HSPC215; MFH; QRF1
Summary This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Categories Chemokines, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXP1" proteins (4)
SKU Description Size Price
PH313862 FOXP1 MS Standard C13 and N15-labeled recombinant protein (NP_116071) 10 ug
$3,360.00
LC403191 Lyophilized FOXP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403191 Transient overexpression lysate of forkhead box P1 (FOXP1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP710030 Recombinant protein of human forkhead box P1 (FOXP1), transcript variant 1,full length, with C-terminal DDK tag, expressed in sf9 cells 20 ug
$540.00

file-alt Citations

Epigenetic memory of colitis promotes tumour growth
Nagaraja, Ojeda-Miron, Zhang et al
Nature (2026)
Cited by 28
AI Summary: In this study, OriGene’s recombinant FOS (TP760257), FOXP1 (TP313862), and FOXA1 (TP306045) proteins were used in in vitro assays to investigate how specific transcription factors contribute to the epigenetic memory of colitis in colonic stem cells.
Snippet: with the following modifications: briefly, selected sequences (25 ng per reaction) were incubated with various combinations of recombinant JUN (Active Motif, 31116), FOS (OriGene, TP760257), FOXP1 (OriGene, TP313862) and FOXA1 protein (OriGene, TP306045)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products