SNX20 (NM_182854) Human Recombinant Protein

SKU
TP313842
Recombinant protein of human sorting nexin 20 (SNX20), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213842 representing NM_182854
Red=Cloning site Green=Tags(s)

MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR
WKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEF
PRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLR
VLPLQEKLTAHCPAAAVPALCAVLLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYAL
GKDFVTLQERLEESQLRRPTPRGITLKELTVREYLH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_878274
Locus ID 124460
UniProt ID Q7Z614
Cytogenetics 16q12.1
RefSeq Size 1457
RefSeq ORF 948
Synonyms SLIC1
Summary SNX20 interacts with the cytoplasmic domain of PSGL1 (SELPLG; MIM 600738) and cycles PSGL1 into endosomes.[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:SNX20 (NM_182854) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313842 SNX20 MS Standard C13 and N15-labeled recombinant protein (NP_878274) 10 ug
$3,255.00
LC405386 SNX20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405386 Transient overexpression lysate of sorting nexin 20 (SNX20), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.