DCL 1 (CD302) (NM_014880) Human Recombinant Protein

SKU
TP313785M
Recombinant protein of human CD302 molecule (CD302), 100 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$1,918.00 MSRP $2,950.00 MSRP $2,950.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213785 representing NM_014880
Red=Cloning site Green=Tags(s)

MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE
ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK
GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ
SPYNEDCVLVVGEENEYPVQFD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055695
Locus ID 9936
UniProt ID Q8IX05
Cytogenetics 2q24.2
RefSeq Size 3740
RefSeq ORF 696
Synonyms BIMLEC; CLEC13A; DCL-1; DCL1
Summary CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:DCL 1 (CD302) (NM_014880) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.