HOXC6 (NM_004503) Human Recombinant Protein

SKU
TP313768
Recombinant protein of human homeobox C6 (HOXC6), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213768 representing NM_004503
Red=Cloning site Green=Tags(s)

MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY
DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD
RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG
GGATADSLGGKEEKREETEEEKQKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004494
Locus ID 3223
UniProt ID P09630
Cytogenetics 12q13.13
RefSeq Size 1681
RefSeq ORF 705
Synonyms CP25; HHO.C8; HOX3; HOX3C
Summary This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HOXC6 (NM_004503) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313768 HOXC6 MS Standard C13 and N15-labeled recombinant protein (NP_004494) 10 ug
$3,255.00
LC401432 HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403515 HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401432 Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 1 100 ug
$436.00
LY403515 Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 2 100 ug
$436.00
TP761182 Purified recombinant protein of Human homeobox C6 (HOXC6), transcript variant 2n, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.