CRMP4 (DPYSL3) (NM_001387) Human Recombinant Protein

SKU
TP313488
Recombinant protein of human dihydropyrimidinase-like 3 (DPYSL3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213488 representing NM_001387
Red=Cloning site Green=Tags(s)

MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI
DVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD
ITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQT
RMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT
ASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTA
IPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIV
SAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD
LHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPP
GGRSNITSLS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001378
Locus ID 1809
UniProt ID Q14195
Cytogenetics 5q32
RefSeq Size 5066
RefSeq ORF 1710
Synonyms CRMP-4; CRMP4; DRP-3; DRP3; LCRMP; ULIP; ULIP-1
Summary Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CRMP4 (DPYSL3) (NM_001387) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313488 DPYSL3 MS Standard C13 and N15-labeled recombinant protein (NP_001378) 10 ug
$3,255.00
LC400542 DPYSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400542 Transient overexpression lysate of dihydropyrimidinase-like 3 (DPYSL3) 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.