Gemin 8 (GEMIN8) (NM_017856) Human Recombinant Protein

SKU
TP313444
Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213444 protein sequence
Red=Cloning site Green=Tags(s)

MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA
AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT
EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA
KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060326
Locus ID 54960
UniProt ID Q9NWZ8
Cytogenetics Xp22.2
RefSeq Size 3259
RefSeq ORF 726
Synonyms FAM51A1
Summary The protein encoded by this gene is part of the SMN complex, which is necessary for spliceosomal snRNP assembly in the cytoplasm and pre-mRNA splicing in the nucleus. The encoded protein binds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediating their interaction. This protein is found in nuclear Gemini of Cajal bodies (gems) and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:Gemin 8 (GEMIN8) (NM_017856) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300165 GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035944) 10 ug
$3,255.00
PH304795 GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_001035945) 10 ug
$3,255.00
PH313444 GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_060326) 10 ug
$3,255.00
LC413420 GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420932 GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420933 GEMIN8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413420 Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 3 100 ug
$436.00
LY420932 Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2 100 ug
$436.00
LY420933 Transient overexpression lysate of gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1 100 ug
$436.00
TP300165 Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 2, 20 µg 20 ug
$867.00
TP304795 Recombinant protein of human gem (nuclear organelle) associated protein 8 (GEMIN8), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.