LHPP (NM_022126) Human Recombinant Protein

SKU
TP313279
Recombinant protein of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213279 protein sequence
Red=Cloning site Green=Tags(s)

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR
LGFDISEQEVTAPAPAACQILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ
VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV
MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_071409
Locus ID 64077
UniProt ID Q9H008
Cytogenetics 10q26.13
RefSeq Size 1703
RefSeq ORF 810
Synonyms HDHD2B
Summary Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Oxidative phosphorylation
Write Your Own Review
You're reviewing:LHPP (NM_022126) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH313279 LHPP MS Standard C13 and N15-labeled recombinant protein (NP_071409) 10 ug
$3,255.00
LC411763 LHPP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432687 LHPP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411763 Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1 100 ug
$436.00
LY432687 Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.