Tcl1 (TCL1A) (NM_001098725) Human Recombinant Protein

SKU TP313051M

Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 2, 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213051 protein sequence; Red=Cloning site Green=Tags(s); ; MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPS; LLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001092195
• Locus ID: 8115
• UniProt ID: P56279
• Cytogenetics: 14q32.13
• RefSeq Size: 1405
• RefSeq ORF: 342
• Synonyms: TCL1
• Summary: Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).[supplied by OMIM, Jul 2010]
• Protein Families: Druggable Genome