C20orf30 (TMEM230) (NM_001009924) Human Recombinant Protein

SKU
TP313024
Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213024 protein sequence
Red=Cloning site Green=Tags(s)

MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY
ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001009924
Locus ID 29058
UniProt ID Q96A57
Cytogenetics 20p13-p12.3
RefSeq Size 1792
RefSeq ORF 360
Synonyms C20orf30; dJ1116H23.2.1; HSPC274
Summary This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:C20orf30 (TMEM230) (NM_001009924) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301878 C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864) 10 ug
$3,255.00
PH313024 C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) 10 ug
$3,255.00
PH324414 C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) 10 ug
$3,255.00
LC415474 TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423152 TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423153 TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415474 Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 100 ug
$436.00
LY423152 Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 100 ug
$436.00
LY423153 Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 100 ug
$436.00
TP301878 Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP324414 Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 30 (C20orf30), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.