Amino terminal enhancer of split (AES) (NM_001130) Human Recombinant Protein
Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212475 representing NM_001130
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALAL PLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121 |
Locus ID | 166 |
UniProt ID | Q08117, Q8WY48 |
Cytogenetics | 19p13.3 |
Refseq Size | 1687 |
Refseq ORF | 591 |
Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
USD 396.00 |
|
LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 |
USD 396.00 |
|
PH312475 | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) |
USD 2,712.00 |
|
PH313043 | AES MS Standard C13 and N15-labeled recombinant protein (NP_945321) |
USD 2,712.00 |
|
TP313043 | Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3 |
USD 823.00 |
USD 385.00
USD 380.00