CCDC149 (NM_173463) Human Recombinant Protein

SKU
TP312457
Recombinant protein of human coiled-coil domain containing 149 (CCDC149), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212457 representing NM_173463
Red=Cloning site Green=Tags(s)

MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL
LRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQGKSSSSAL
TGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775734
Locus ID 91050
UniProt ID Q6ZUS6
Cytogenetics 4p15.2
RefSeq Size 5606
RefSeq ORF 801
Write Your Own Review
You're reviewing:CCDC149 (NM_173463) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312457 CCDC149 MS Standard C13 and N15-labeled recombinant protein (NP_775734) 10 ug
$3,255.00
PH325905 CCDC149 MS Standard C13 and N15-labeled recombinant protein (NP_001124198) 10 ug
$3,255.00
LC406617 CCDC149 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427269 CCDC149 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406617 Transient overexpression lysate of coiled-coil domain containing 149 (CCDC149), transcript variant 1 100 ug
$436.00
LY427269 Transient overexpression lysate of coiled-coil domain containing 149 (CCDC149), transcript variant 2 100 ug
$436.00
TP325905 Recombinant protein of human coiled-coil domain containing 149 (CCDC149), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.