FUT8 (NM_178154) Human Recombinant Protein

SKU
TP312345
Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212345 representing NM_178154
Red=Cloning site Green=Tags(s)

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP
EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL
EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL
VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE
VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT
KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF
HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE
KIETVKYPTYPEAEK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 66.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835367
Locus ID 2530
UniProt ID Q9BYC5
Cytogenetics 14q23.3
RefSeq Size 3291
RefSeq ORF 1725
Synonyms MGC26465
Summary This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]
Protein Families Transmembrane
Protein Pathways Keratan sulfate biosynthesis, Metabolic pathways, N-Glycan biosynthesis
Write Your Own Review
You're reviewing:FUT8 (NM_178154) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312345 FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835367) 10 ug
$3,255.00
PH323075 FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835368) 10 ug
$3,255.00
LC406001 FUT8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406002 FUT8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406003 FUT8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406001 Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2 100 ug
$665.00
LY406002 Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1 100 ug
$665.00
LY406003 Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 3 100 ug
$665.00
TP323075 Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.