WBP5 (TCEAL9) (NM_016303) Human Recombinant Protein

SKU TP312064M

Recombinant protein of human WW domain binding protein 5 (WBP5), transcript variant 1, 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212064 protein sequence; Red=Cloning site Green=Tags(s); ; MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM; FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057387
• Locus ID: 51186
• UniProt ID: Q9UHQ7
• Cytogenetics: Xq22.2
• RefSeq Size: 1102
• RefSeq ORF: 312
• Synonyms: WBP5; WEX6
• Summary: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]