EDF1 (NM_153200) Human Recombinant Protein

CAT#: TP312036

Purified recombinant protein of Homo sapiens endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 20 µg

Product Images

Coomassie blue staining of purified EDF1 protein (Cat# TP312036). The protein was produced from HEK293T cells transfected with EDF1 cDNA clone (Cat# RC212036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212036 representing NM_153200
  Red=Cloning site Green=Tags(s)
  
  MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH
  DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGECPSTLRRVR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694880
• Locus ID: 8721
• UniProt ID: O60869
• Cytogenetics: 9q34.3
• Refseq Size: 538
• Refseq ORF: 417
• Synonyms: CFAP280; EDF-1; MBF1
• Summary: This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Transcription Factors