PALM2AKAP2 (NM_053016) Human Recombinant Protein

SKU
TP311908
Purified recombinant protein of Homo sapiens paralemmin 2 (PALM2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211908 representing NM_053016
Red=Cloning site Green=Tags(s)

MAEAELHKERLQAIAEKRKRQTEIEGKRQQLDEQILLLQHSKSKVLREKWLLQGIPAGTAEEEEARRRQS
EEDEFRVKQLEDNIQRLEQEIQTLESEESQISAKEQIILEKLKETEKSFKDFQKGFSSTDGDAVNYISSQ
LPDLPILCSRTAEPSPGQDGTSRAAAVYAMEINVEKDKQTGETKILSTSTIGPEGVHQKGVKVYDDGTKV
VYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHK
SRKDHSSGNPGQQAQAPSAAGPEANLDQPVTMIFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKS
LREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_443749
Locus ID 445815
UniProt ID Q8IXS6
Cytogenetics 9q31.3
RefSeq Size 9363
RefSeq ORF 1233
Synonyms AKAP-2; AKAP-KL; AKAP2; AKAPKL; MISP2; PALM2; PALM2-AKAP2; PRKA2
Summary This gene belongs to the paralemmin downstream gene (PDG) family defined in PMID:22855693. Paralemmin downstream genes may have evolved contiguously with the paralemmin genes and are associated with other paralemmin paralogs in humans and several other taxa. The gene encodes three distinct protein isoforms, the PALM2 isoform, the AKAP2 isoform and the PALM2-AKAP2 isoform. The biological significance of the PALM2-AKAP2 isoforms is yet unknown. Earlier, PALM2 and AKAP2 were annotated as separate genes and PALM2-AKAP2 was annotated as a readthrough gene. [provided by RefSeq, May 2019]
Write Your Own Review
You're reviewing:PALM2AKAP2 (NM_053016) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306919 PALM2 MS Standard C13 and N15-labeled recombinant protein (NP_001032370) 10 ug
$3,255.00
PH311908 PALM2 MS Standard C13 and N15-labeled recombinant protein (NP_443749) 10 ug
$3,255.00
LC409323 PALM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421942 PALM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424061 AKAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429900 PALM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409323 Transient overexpression lysate of paralemmin 2 (PALM2), transcript variant 1 100 ug
$436.00
LY421942 Transient overexpression lysate of paralemmin 2 (PALM2), transcript variant 2 100 ug
$436.00
LY424061 Transient overexpression lysate of A kinase (PRKA) anchor protein 2 (AKAP2), transcript variant 1 100 ug
$665.00
LY429900 Transient overexpression lysate of paralemmin 2 (PALM2), transcript variant 1 100 ug
$436.00
TP306919 Recombinant protein of human paralemmin 2 (PALM2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.