MID1 (NM_033290) Human Recombinant Protein

SKU
TP311781
Recombinant protein of human midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211781 representing NM_033290
Red=Cloning site Green=Tags(s)

METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCRHVITLSQRGL
DGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVS
YCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVA
ALSERYDKLKQNLESNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQII
GTKIKEGKVMRLRKLAQQIANCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLI
PEINLNDTFDTFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLKTNSQPFKLDP
KSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVVISGSTWYAIGLAYK
SAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPHLRRVGILLDYDNGSIAFYDALNSIHLYTFD
VAFAQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQLP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 75.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_150632
Locus ID 4281
UniProt ID O15344
Cytogenetics Xp22.2
RefSeq Size 3117
RefSeq ORF 2001
Synonyms BBBG1; FXY; GBBB1; MIDIN; OGS1; OS; OSX; RNF59; TRIM18; XPRF; ZNFXY
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also known as the 'RING-B box-coiled coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein forms homodimers which associate with microtubules in the cytoplasm. The protein is likely involved in the formation of multiprotein structures acting as anchor points to microtubules. Mutations in this gene have been associated with the X-linked form of Opitz syndrome, which is characterized by midline abnormalities such as cleft lip, laryngeal cleft, heart defects, hypospadias, and agenesis of the corpus callosum. This gene was also the first example of a gene subject to X inactivation in human while escaping it in mouse. Alternative promoter use, alternative splicing and alternative polyadenylation result in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:MID1 (NM_033290) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308776 MID1 MS Standard C13 and N15-labeled recombinant protein (NP_000372) 10 ug
$3,255.00
PH311781 MID1 MS Standard C13 and N15-labeled recombinant protein (NP_150632) 10 ug
$3,255.00
PH313454 MID1 MS Standard C13 and N15-labeled recombinant protein (NP_001092094) 10 ug
$3,255.00
LC409610 MID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420647 MID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424750 MID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409610 Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 3 100 ug
$436.00
LY420647 Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 4 100 ug
$665.00
LY424750 Transient overexpression lysate of midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 1 100 ug
$436.00
TP308776 Purified recombinant protein of Homo sapiens midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 1, 20 µg 20 ug
$867.00
TP313454 Recombinant protein of human midline 1 (Opitz/BBB syndrome) (MID1), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.