Prominin 2 (PROM2) (NM_144707) Human Recombinant Protein

SKU
TP311605
Recombinant protein of human prominin 2 (PROM2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211605 representing NM_144707
Red=Cloning site Green=Tags(s)

MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLLDSLYGTVRRF
LSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLVPTAGLCFCCCRCHRRCGGRV
KTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTHEQMGPSIEAMPETLLSLWGLVSDVPQELQA
VAQQFSLPQEQVSEELDGVGVSIGSAIHTQLRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQ
QDLEPAIREHRDRLLELLQEARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQE
ENSTFNALPALAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGLSFLFAAPLIL
LVFATFLVGGNVQTLVCRSWENGELFEFADTPGNLPPSMNLSQLLGLRKNISIHQAYQQCKEGAALWTVL
QLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSSAARRDLEALQSSGLQRIHYPDFLVQIQRPV
VKTSMEQLAQELQGLAQAQDNSVLGQRLQEEAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLE
TSDVLANVTYLKGELPAWAARILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVIL
CDMMADPWNAFWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 91.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_653308
Locus ID 150696
UniProt ID Q8N271
Cytogenetics 2q11.1
RefSeq Size 3822
RefSeq ORF 2502
Synonyms PROML2
Summary This gene encodes a member of the prominin family of pentaspan membrane glycoproteins. The encoded protein localizes to basal epithelial cells and may be involved in the organization of plasma membrane microdomains. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:Prominin 2 (PROM2) (NM_144707) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311605 PROM2 MS Standard C13 and N15-labeled recombinant protein (NP_653308) 10 ug
$3,255.00
LC403405 PROM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432052 PROM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432053 PROM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403405 Transient overexpression lysate of prominin 2 (PROM2), transcript variant 3 100 ug
$665.00
LY432052 Transient overexpression lysate of prominin 2 (PROM2), transcript variant 1 100 ug
$665.00
LY432053 Transient overexpression lysate of prominin 2 (PROM2), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.