ODF4 (NM_153007) Human Recombinant Protein

SKU TP311295

Recombinant protein of human outer dense fiber of sperm tails 4 (ODF4), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211295 protein sequence; Red=Cloning site Green=Tags(s); ; MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGRGTGELGQDGRLLSSTLSLSSNRSLGQRQNSPLPFQW; RITHSFRWMAQVLASELSLVAFILLLVMAFSKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFCK; SRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILCYFNHKSFWSL; ILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDPEQKDTHV; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_694552
• Locus ID: 146852
• UniProt ID: Q2M2E3
• Cytogenetics: 17p13.1
• RefSeq Size: 1149
• RefSeq ORF: 771
• Synonyms: CT134; CT136; OPPO1
• Summary: This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Transmembrane