GM CSF (CSF2) (NM_000758) Human Recombinant Protein

SKU
TP311109
Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211109 protein sequence
Red=Cloning site Green=Tags(s)

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPT
CLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWE
PVQE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000749
Locus ID 1437
UniProt ID P04141
Cytogenetics 5q31.1
RefSeq Size 800
RefSeq ORF 432
Synonyms CSF; GMCSF
Summary The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Fc epsilon RI signaling pathway, Hematopoietic cell lineage, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:GM CSF (CSF2) (NM_000758) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311109 CSF2 MS Standard C13 and N15-labeled recombinant protein (NP_000749) 10 ug
$3,255.00
LC400257 CSF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400257 Transient overexpression lysate of colony stimulating factor 2 (granulocyte-macrophage) (CSF2) 100 ug
$436.00
TP720003 Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) 10 ug
$285.00
TP720031 Recombinant protein of human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) 10 ug
$265.00
TP721106 Purified recombinant protein of Human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) 10 ug
$250.00
TP723720 Purified recombinant protein of Human colony stimulating factor 2 (granulocyte-macrophage) (CSF2) 10 ug
$345.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.