PGRPS (PGLYRP1) (NM_005091) Human Recombinant Protein

SKU
TP311040
Recombinant protein of human peptidoglycan recognition protein 1 (PGLYRP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC211040 protein sequence
Red=Cloning site Green=Tags(s)

MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP
ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP
TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005082
Locus ID 8993
UniProt ID O75594
Cytogenetics 19q13.32
RefSeq Size 972
RefSeq ORF 588
Synonyms PGLYRP; PGRP; PGRP-S; PGRPS; TAG7; TNFSF3L
Summary Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:PGRPS (PGLYRP1) (NM_005091) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311040 PGLYRP1 MS Standard C13 and N15-labeled recombinant protein (NP_005082) 10 ug
$3,255.00
LC417530 PGLYRP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417530 Transient overexpression lysate of peptidoglycan recognition protein 1 (PGLYRP1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.