Resistin (RETN) (NM_020415) Human Recombinant Protein
CAT#: TP310942
Recombinant protein of human resistin (RETN), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210942 protein sequence
Red=Cloning site Green=Tags(s) MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Cell treatment (PMID: 26952643) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065148 |
Locus ID | 56729 |
UniProt ID | Q9HD89 |
Cytogenetics | 19p13.2 |
Refseq Size | 478 |
Refseq ORF | 324 |
Synonyms | ADSF; FIZZ3; RETN1; RSTN; XCP1 |
Summary | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402786 | RETN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402786 | Transient overexpression lysate of resistin (RETN) |
USD 436.00 |
|
PH310942 | RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) |
USD 3,255.00 |
|
TP720988 | Purified recombinant protein of Human resistin (RETN), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review