Resistin (RETN) (NM_020415) Human Mass Spec Standard

SKU PH310942

RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210942]
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210942 protein sequence; Red=Cloning site Green=Tags(s); ; MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT; GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_065148
• RefSeq Size: 478
• RefSeq ORF: 324
• Synonyms: ADSF; FIZZ3; RETN1; RSTN; XCP1
• Locus ID: 56729
• UniProt ID: Q9HD89
• Cytogenetics: 19p13.2
• Summary: This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2020]
• Protein Families: Druggable Genome, Secreted Protein