CCDC48 (EFCC1) (NM_024768) Human Recombinant Protein

SKU
TP310842
Recombinant protein of human coiled-coil domain containing 48 (CCDC48), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210842 representing NM_024768
Red=Cloning site Green=Tags(s)

MTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKVEENEHLRLELQMVETER
VRLSLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLR
RQPSAPASAAAALTNPLLVSC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079044
Locus ID 79825
UniProt ID Q9HA90
Cytogenetics 3q21.3
RefSeq Size 1963
RefSeq ORF 483
Synonyms C3orf73; CCDC48
Write Your Own Review
You're reviewing:CCDC48 (EFCC1) (NM_024768) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC432321 EFCC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY432321 Transient overexpression lysate of coiled-coil domain containing 48 (CCDC48) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.