NIT2 (NM_020202) Human Recombinant Protein

CAT#: TP310660

Recombinant protein of human nitrilase family, member 2 (NIT2)

Size: 20 ug 100 ug 1 mg



  View other "NIT2" proteins (3)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Anti-NIT2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
    • 30 ul

USD 200.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "NIT2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC210660 protein sequence
Red=Cloning site Green=Tags(s)

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity Enzyme activity (PMID: 28358347)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_064587
Locus ID 56954
UniProt ID Q9NQR4, V9HW91
Cytogenetics 3q12.2
Refseq Size 1271
Refseq ORF 828
Synonyms HEL-S-8a
Summary Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.[UniProtKB/Swiss-Prot Function]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.