NIT2 (NM_020202) Human Mass Spec Standard

SKU
PH310660
NIT2 MS Standard C13 and N15-labeled recombinant protein (NP_064587)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210660]
Predicted MW 30.6 kDa
Protein Sequence
Protein Sequence
>RC210660 protein sequence
Red=Cloning site Green=Tags(s)

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS
EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST
FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR
DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064587
RefSeq Size 1271
RefSeq ORF 828
Synonyms HEL-S-8a
Locus ID 56954
UniProt ID Q9NQR4
Cytogenetics 3q12.2
Summary Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NIT2 (NM_020202) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402761 NIT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402761 Transient overexpression lysate of nitrilase family, member 2 (NIT2) 100 ug
$436.00
TP310660 Recombinant protein of human nitrilase family, member 2 (NIT2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.