SNRPE (NM_003094) Human Recombinant Protein

SKU TP310556L

Recombinant protein of human small nuclear ribonucleoprotein polypeptide E (SNRPE), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210556 representing NM_003094; Red=Cloning site Green=Tags(s); ; MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS; RKQLGRIMLKGDNITLLQSVSN; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003085
• Locus ID: 6635
• UniProt ID: P62304
• Cytogenetics: 1q32.1
• RefSeq Size: 1593
• RefSeq ORF: 276
• Synonyms: HYPT11; Sm-E; SME; snRNP-E
• Summary: The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome