MOX1 (MEOX1) (NM_004527) Human Recombinant Protein

SKU TP310106L

Recombinant protein of human mesenchyme homeobox 1 (MEOX1), transcript variant 1, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210106 protein sequence; Red=Cloning site Green=Tags(s); ; MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT; PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST; ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL; SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004518
• Locus ID: 4222
• UniProt ID: P50221
• Cytogenetics: 17q21.31
• RefSeq Size: 2330
• RefSeq ORF: 762
• Synonyms: KFS2; MOX1
• Summary: This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors