PDLIM2 (NM_021630) Human Recombinant Protein
CAT#: TP310022
Recombinant protein of human PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210022 protein sequence
Red=Cloning site Green=Tags(s) MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS RA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067643 |
Locus ID | 64236 |
UniProt ID | Q96JY6 |
Cytogenetics | 8p21.3 |
Refseq Size | 2246 |
Refseq ORF | 1056 |
Synonyms | MYSTIQUE; SLIM |
Summary | This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406049 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC411957 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430460 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406049 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 |
USD 436.00 |
|
LY411957 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2 |
USD 436.00 |
|
LY430460 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 |
USD 436.00 |
|
PH310022 | PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_067643) |
USD 3,255.00 |
|
PH319644 | PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_789847) |
USD 3,255.00 |
|
TP319644 | Purified recombinant protein of Homo sapiens PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review