OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDLIM2 (NM_176871) Human Mass Spec Standard

Be the first to review this product
SKU
PH319644
PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_789847)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502708 PDLIM2 mouse monoclonal antibody, clone OTI10C4 (formerly 10C4) 100 ul
$447.00
LY406049 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PDLIM2 or NM_176871"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219644
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC219644 representing NM_176871
Red=Cloning site Green=Tags(s)

MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWEDACAMEGMRLSLEALEGMVEGA
KRRDRRKTRRPIQPSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789847
RefSeq Size 4611
RefSeq ORF 1098
Synonyms MYSTIQUE; SLIM
Locus ID 64236
UniProt ID Q96JY6
Cytogenetics 8p21.3
Summary This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDLIM2" proteins (9)
SKU Description Size Price
PH310022 PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_067643) 10 ug
$3,360.00
LC406049 Lyophilized PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411957 Lyophilized PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430460 Lyophilized PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406049 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY411957 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY430460 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310022 Recombinant protein of human PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2, 20 µg 20 ug
$867.00
TP319644 Purified recombinant protein of Homo sapiens PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products