PDLIM2 (NM_176871) Human Mass Spec Standard

SKU
PH319644
PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_789847)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219644]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC219644 representing NM_176871
Red=Cloning site Green=Tags(s)

MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWEDACAMEGMRLSLEALEGMVEGA
KRRDRRKTRRPIQPSW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789847
RefSeq Size 4611
RefSeq ORF 1098
Synonyms MYSTIQUE; SLIM
Locus ID 64236
UniProt ID Q96JY6
Cytogenetics 8p21.3
Summary This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:PDLIM2 (NM_176871) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310022 PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_067643) 10 ug
$3,255.00
LC406049 PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411957 PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430460 PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406049 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 100 ug
$436.00
LY411957 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2 100 ug
$436.00
LY430460 Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 100 ug
$436.00
TP310022 Recombinant protein of human PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319644 Purified recombinant protein of Homo sapiens PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.