EEF1A1 (NM_001402) Human Recombinant Protein
CAT#: TP309697
Recombinant protein of human eukaryotic translation elongation factor 1 alpha 1 (EEF1A1), 20 µg
USD 471.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209697 protein sequence
Red=Cloning site Green=Tags(s) MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | ELISA capture for autoantibodies (PMID: 26616590) Biolayer interferometry (BLI) assay (PMID: 26624286) Binding assay (PMID: 29588400) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001393 |
Locus ID | 1915 |
UniProt ID | P68104, Q6IPS9 |
Cytogenetics | 6q13 |
Refseq Size | 3528 |
Refseq ORF | 1386 |
Synonyms | CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; LENG7; PTI1 |
Summary | This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419954 | EEF1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419954 | Transient overexpression lysate of eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) |
USD 436.00 |
|
PH309697 | EEF1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001393) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review