Hsp20 (HSPB6) (NM_144617) Human Recombinant Protein

SKU TP309637

Recombinant protein of human heat shock protein, alpha-crystallin-related, B6 (HSPB6), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209637 protein sequence; Red=Cloning site Green=Tags(s); ; MEIPVPVQPSWLRRASAPLLGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTD; PGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEG; VLSIQAAPASAQAPPPAAAK; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_653218
• Locus ID: 126393
• UniProt ID: O14558
• Cytogenetics: 19q13.12
• RefSeq Size: 1480
• RefSeq ORF: 480
• Synonyms: HEL55; Hsp20; PPP1R91
• Summary: This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012]