Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Recombinant Protein

SKU
TP309533
Recombinant protein of human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209533 protein sequence
Red=Cloning site Green=Tags(s)

MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVV
SVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK
MKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLT
SRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKL
SVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE
DLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEI
SEESGE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057375
Locus ID 51447
UniProt ID Q9UHH9
Cytogenetics 3p21.31
RefSeq Size 1813
RefSeq ORF 1278
Synonyms IHPK2; InsP6K2; PIUS
Summary This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Inositol Hexakisphosphate Kinase 2 (IP6K2) (NM_016291) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309533 IP6K2 MS Standard C13 and N15-labeled recombinant protein (NP_057375) 10 ug
$3,255.00
LC414064 IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423667 IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425158 IP6K2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414064 Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 1 100 ug
$436.00
LY423667 Transient overexpression lysate of inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2 100 ug
$665.00
TP760718 Purified recombinant protein of Human inositol hexakisphosphate kinase 2 (IP6K2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.