OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASB7 (NM_024708) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309502
Recombinant protein of human ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337610 Rabbit Polyclonal Anti-ASB7 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ASB7 or NM_024708"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209502 protein sequence
Red=Cloning site Green=Tags(s)

MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHG
ADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFK
AEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQNGFLLRYAVIKSNHSYCRMFLQRGADTNLGR
LEDGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCLDFLQEVTSM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_078984
Locus ID 140460
UniProt ID Q9H672
Cytogenetics 15q26.3
RefSeq Size 1769
RefSeq ORF 822
Summary The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASB7" proteins (5)
SKU Description Size Price
PH309502 ASB7 MS Standard C13 and N15-labeled recombinant protein (NP_078984) 10 ug
$3,360.00
LC404964 Lyophilized ASB7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411164 Lyophilized ASB7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404964 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY411164 Transient overexpression lysate of ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products