C1orf198 (NM_032800) Human Recombinant Protein

SKU
TP309490
Recombinant protein of human chromosome 1 open reading frame 198 (C1orf198), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209490 representing NM_032800
Red=Cloning site Green=Tags(s)

MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEII
DRCLVGPRAPAPRDPGDSEELTRFPGLRGPTGQKVVRFGDEDLTWQDEHSAPFSWETKSQMEFSISALSI
QEPSNGTAASEPRPLSKASQGSQALKSSQGSRSSSLDALGPTRKEEEASFWKINAERSRGEGPEAEFQSL
TPSQIKSMEKGEKVLPPCYRQEPAPKDREAKVERPSTLRQEQRPLPNVSTERERPQPVQAFSSALHEAAP
SQLEGKLPSPDVRQDDGEDTLFSEPKFAQVSSSNVVLKTGFDFLDNW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116189
Locus ID 84886
UniProt ID Q9H425
Cytogenetics 1q42.2
RefSeq Size 3733
RefSeq ORF 981
Write Your Own Review
You're reviewing:C1orf198 (NM_032800) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309490 C1orf198 MS Standard C13 and N15-labeled recombinant protein (NP_116189) 10 ug
$3,255.00
LC409807 C1orf198 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427895 C1orf198 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409807 Transient overexpression lysate of chromosome 1 open reading frame 198 (C1orf198), transcript variant 1 100 ug
$436.00
LY427895 Transient overexpression lysate of chromosome 1 open reading frame 198 (C1orf198), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.