Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Recombinant Protein
SKU
TP309406
Recombinant protein of human selenophosphate synthetase 1 (SEPHS1), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC209406 protein sequence
Red=Cloning site Green=Tags(s) MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_036379 |
Locus ID | 22929 |
UniProt ID | P49903 |
Cytogenetics | 10p13 |
RefSeq Size | 3275 |
RefSeq ORF | 1176 |
Synonyms | SELD; SPS; SPS1 |
Summary | This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Selenoamino acid metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH309406 | SEPHS1 MS Standard C13 and N15-labeled recombinant protein (NP_036379) | 10 ug |
$3,255.00
|
|
LC415883 | SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434161 | SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415883 | Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1) | 100 ug |
$436.00
|
|
LY434161 | Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1), transcript variant 3 | 100 ug |
$436.00
|
|
TP710322 | Purified recombinant protein of Human aprataxin and PNKP like factor (APLF), full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP760692 | Purified recombinant protein of Human selenophosphate synthetase 1 (SEPHS1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.