Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Recombinant Protein

SKU
TP309406
Recombinant protein of human selenophosphate synthetase 1 (SEPHS1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209406 protein sequence
Red=Cloning site Green=Tags(s)

MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT
CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV
MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA
VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK
QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ
AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036379
Locus ID 22929
UniProt ID P49903
Cytogenetics 10p13
RefSeq Size 3275
RefSeq ORF 1176
Synonyms SELD; SPS; SPS1
Summary This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010]
Protein Families Stem cell - Pluripotency
Protein Pathways Metabolic pathways, Selenoamino acid metabolism
Write Your Own Review
You're reviewing:Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309406 SEPHS1 MS Standard C13 and N15-labeled recombinant protein (NP_036379) 10 ug
$3,255.00
LC415883 SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434161 SEPHS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415883 Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1) 100 ug
$436.00
LY434161 Transient overexpression lysate of selenophosphate synthetase 1 (SEPHS1), transcript variant 3 100 ug
$436.00
TP710322 Purified recombinant protein of Human aprataxin and PNKP like factor (APLF), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP760692 Purified recombinant protein of Human selenophosphate synthetase 1 (SEPHS1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.