NSMCE4A (NM_017615) Human Recombinant Protein

SKU
TP309357L
Recombinant protein of human non-SMC element 4 homolog A (S. cerevisiae) (NSMCE4A), 1 mg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$5,980.00 MSRP $9,200.00 MSRP $9,200.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209357 protein sequence
Red=Cloning site Green=Tags(s)

MSGDSSGRGGRGRGRDHRDRTRSRSRSRSSRSRRGSARRRARSDTSDSGDMMDASAADGCRRHYRANSVN
RDNAGDKTVANTNVSRARAVDAHVASDGKKAKRSDSSDMRYVTTHMGVNARDDSDVYDSWKTGRTANTNK
THTHGSYGCVKRVDRRKVVRAMARRMSHATKVRGTYRDDTMSDVVDHSRTVNHVSRDGARRDDRVVSNNG
HNTVRNGASYRDWVKTSVTSRKSA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060085
Locus ID 54780
UniProt ID Q9NXX6
Cytogenetics 10q26.13
RefSeq Size 1420
RefSeq ORF 1158
Synonyms C10orf86; NS4EA; NSE4A
Summary Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Is involved in positive regulation of response to DNA damage stimulus.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NSMCE4A (NM_017615) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.