GNG2 (NM_053064) Human Recombinant Protein

SKU
TP309299
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 2 (GNG2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209299 protein sequence
Red=Cloning site Green=Tags(s)

MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
L

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 7.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_444292
Locus ID 54331
UniProt ID P59768
Cytogenetics 14q22.1
RefSeq Size 3903
RefSeq ORF 213
Summary This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway
Write Your Own Review
You're reviewing:GNG2 (NM_053064) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309299 GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292) 10 ug
$3,255.00
LC403285 GNG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403285 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 2 (GNG2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.