HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

SKU
TP309098
Recombinant protein of human hepatitis B virus x interacting protein (HBXIP), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209098 protein sequence
Red=Cloning site Green=Tags(s)

MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV
PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD
PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006393
Locus ID 10542
UniProt ID O43504
Cytogenetics 1p13.3
RefSeq Size 855
RefSeq ORF 519
Synonyms HBXIP; XIP
Summary This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309098 HBXIP MS Standard C13 and N15-labeled recombinant protein (NP_006393) 10 ug
$3,255.00
LC401923 LAMTOR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401923 Transient overexpression lysate of hepatitis B virus x interacting protein (HBXIP) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.