SKAR (POLDIP3) (NM_178136) Human Recombinant Protein

SKU
TP308957
Purified recombinant protein of Human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208957 representing NM_178136
Red=Cloning site Green=Tags(s)

MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG
VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT
PALKLTKTIQNLYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAP
ALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRA
RLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKESELPR
RVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIKL

myc-FLAG tag
Tag Myc-DDK
Predicted MW 42.7 kDa
Concentration >0.05 µg/µL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835237
Locus ID 84271
UniProt ID Q9BY77 Q9BY77-2
Cytogenetics 22q13.2
RefSeq Size 3348
RefSeq ORF 1176
Synonyms PDIP3; PDIP46; SKAR
Summary This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:SKAR (POLDIP3) (NM_178136) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310583 POLDIP3 MS Standard C13 and N15-labeled recombinant protein (NP_115687) 10 ug
$3,255.00
LC410211 POLDIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410211 Transient overexpression lysate of polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1 100 ug
$436.00
TP310583 Recombinant protein of human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.